PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P30330_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 263aa    MW: 29542.1 Da    PI: 4.8932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P30330_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33.2e-1947100356
                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             k++++++eq+++Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  GSMUA_Achr10P30330_001  47 KKRRLSTEQVRALEKNFEVENKLEPERKVRLAKELGLQPRQVAVWFQNRRARWK 100
                             45689************************************************9 PP

2HD-ZIP_I/II134.15e-4347138293
             HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                             kkrrls+eqv++LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal+ + ++L++++e+L 
  GSMUA_Achr10P30330_001  47 KKRRLSTEQVRALEKNFEVENKLEPERKVRLAKELGLQPRQVAVWFQNRRARWKTKQLEHDYAALRTSYDALRLDFDSLHRDKESLL 133
                             9*************************************************************************************9 PP

             HD-ZIP_I/II  89 eelke 93 
                             +++++
  GSMUA_Achr10P30330_001 134 SQIDD 138
                             99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.37842102IPR001356Homeobox domain
SuperFamilySSF466894.71E-2043104IPR009057Homeodomain-like
SMARTSM003892.4E-1845106IPR001356Homeobox domain
CDDcd000861.74E-1647103No hitNo description
PfamPF000461.9E-1647100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-2049109IPR009057Homeodomain-like
PRINTSPR000311.0E-57382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000311.0E-58298IPR000047Helix-turn-helix motif
PfamPF021838.0E-17102143IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MTSWLAGEDQ EDVYGGDFQP IMEGLDEDDG GGDEELCAAT TAGGGAKKRR LSTEQVRALE  60
KNFEVENKLE PERKVRLAKE LGLQPRQVAV WFQNRRARWK TKQLEHDYAA LRTSYDALRL  120
DFDSLHRDKE SLLSQIDDLK AKLAETEGLS LSFSSSAKEG PAVPETAAKA PESEDPPAAI  180
CKDGSSSSDS SAVHHEVLKM EEEELLCEPC CSFFSDEQAA TLNCPKKREN RWEKKELNIK  240
KRSNFIRKLL GKMLINLDNF KFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194102RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381489.11e-113PREDICTED: homeobox-leucine zipper protein HOX20-like
SwissprotA2YWC06e-56HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2486e-56HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLM0RMQ70.0M0RMQ7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P30330_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.13e-47homeobox protein 6